Lineage for d6zzyc_ (6zzy C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949080Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2949145Protein automated matches [236563] (10 species)
    not a true protein
  7. 2949148Species Chlorella ohadii [TaxId:2649997] [420098] (2 PDB entries)
  8. 2949150Domain d6zzyc_: 6zzy C: [417497]
    Other proteins in same PDB: d6zzy1_, d6zzy4_, d6zzy7_, d6zzy8_, d6zzy9_, d6zzya_, d6zzyb_, d6zzyd_, d6zzye_, d6zzyf_, d6zzyj_, d6zzyl_
    automated match to d6k61c_
    complexed with 3ph, 4rf, a8s, bcr, c7z, chl, cl0, cla, dga, dgd, ech, erg, gg0, lap, lhg, lmt, lpx, lut, ola, p5s, pcw, plm, pqn, pty, qtb, rrx, sf4, sph, sqd, xat

Details for d6zzyc_

PDB Entry: 6zzy (more details), 3.16 Å

PDB Description: structure of high-light grown chlorella ohadii photosystem i
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d6zzyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zzyc_ d.58.1.2 (C:) automated matches {Chlorella ohadii [TaxId: 2649997]}
shtvkiydtcigctqcvracptdvlemvpwdgckanqiasaprtedcvgckrcesacptd
flsvrvylgsettrsmglay

SCOPe Domain Coordinates for d6zzyc_:

Click to download the PDB-style file with coordinates for d6zzyc_.
(The format of our PDB-style files is described here.)

Timeline for d6zzyc_:

  • d6zzyc_ is new in SCOPe 2.08-stable