Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein automated matches [236563] (10 species) not a true protein |
Species Chlorella ohadii [TaxId:2649997] [420098] (2 PDB entries) |
Domain d6zzyc_: 6zzy C: [417497] Other proteins in same PDB: d6zzy1_, d6zzy4_, d6zzy7_, d6zzy8_, d6zzy9_, d6zzya_, d6zzyb_, d6zzyd_, d6zzye_, d6zzyf_, d6zzyj_, d6zzyl_ automated match to d6k61c_ complexed with 3ph, 4rf, a8s, bcr, c7z, chl, cl0, cla, dga, dgd, ech, erg, gg0, lap, lhg, lmt, lpx, lut, ola, p5s, pcw, plm, pqn, pty, qtb, rrx, sf4, sph, sqd, xat |
PDB Entry: 6zzy (more details), 3.16 Å
SCOPe Domain Sequences for d6zzyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zzyc_ d.58.1.2 (C:) automated matches {Chlorella ohadii [TaxId: 2649997]} shtvkiydtcigctqcvracptdvlemvpwdgckanqiasaprtedcvgckrcesacptd flsvrvylgsettrsmglay
Timeline for d6zzyc_: