Lineage for d6k61c_ (6k61 c:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949080Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2949145Protein automated matches [236563] (10 species)
    not a true protein
  7. 2949160Species Nostoc sp. [TaxId:103690] [375536] (1 PDB entry)
  8. 2949161Domain d6k61c_: 6k61 c: [375537]
    Other proteins in same PDB: d6k61a_, d6k61b_, d6k61d_, d6k61e_, d6k61f_, d6k61j_, d6k61l_, d6k61m_
    automated match to d1jb0c_
    complexed with bcr, cl0, cla, lhg, lmg, pqn, sf4, sqd

Details for d6k61c_

PDB Entry: 6k61 (more details), 2.37 Å

PDB Description: cryo-em structure of the tetrameric photosystem i from a heterocyst- forming cyanobacterium anabaena sp. pcc7120
PDB Compounds: (c:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d6k61c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k61c_ d.58.1.2 (c:) automated matches {Nostoc sp. [TaxId: 103690]}
shtvkiydtcigctqcvracptdvlemvpwdgckaaqvassprtedcvgckrcetacptd
flsirvylgaettrsmglay

SCOPe Domain Coordinates for d6k61c_:

Click to download the PDB-style file with coordinates for d6k61c_.
(The format of our PDB-style files is described here.)

Timeline for d6k61c_: