![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
![]() | Protein automated matches [236563] (10 species) not a true protein |
![]() | Species Nostoc sp. [TaxId:103690] [375536] (1 PDB entry) |
![]() | Domain d6k61c_: 6k61 c: [375537] Other proteins in same PDB: d6k61a_, d6k61b_, d6k61d_, d6k61e_, d6k61f_, d6k61j_, d6k61l_, d6k61m_ automated match to d1jb0c_ complexed with bcr, cl0, cla, lhg, lmg, pqn, sf4, sqd |
PDB Entry: 6k61 (more details), 2.37 Å
SCOPe Domain Sequences for d6k61c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k61c_ d.58.1.2 (c:) automated matches {Nostoc sp. [TaxId: 103690]} shtvkiydtcigctqcvracptdvlemvpwdgckaaqvassprtedcvgckrcetacptd flsirvylgaettrsmglay
Timeline for d6k61c_: