Lineage for d2mbra1 (2mbr A:3-200)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2547977Family d.145.1.2: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56184] (1 protein)
  6. 2547978Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56185] (2 species)
  7. 2547979Species Escherichia coli [TaxId:562] [56186] (5 PDB entries)
  8. 2547981Domain d2mbra1: 2mbr A:3-200 [41749]
    Other proteins in same PDB: d2mbra2
    complexed with epu, fad

Details for d2mbra1

PDB Entry: 2mbr (more details), 1.8 Å

PDB Description: murb wild type, complex with enolpyruvyl-udp-n-acetylglucosamine
PDB Compounds: (A:) uridine diphospho-n-acetylenolpyruvylglucosamine reductase

SCOPe Domain Sequences for d2mbra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mbra1 d.145.1.2 (A:3-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli [TaxId: 562]}
hslkpwntfgidhnaqhivcaedeqqllnawqyataegqpvlilgegsnvlfledyrgtv
iinrikgieihdepdawylhvgagenwhrlvkytlqegmpglenlalipgcvgsspiqni
gaygvelqrvcayvdsvelatgkqvrltakecrfgyrdsifkheyqdrfaivavglrlpk
ewqpvltygdltrldptt

SCOPe Domain Coordinates for d2mbra1:

Click to download the PDB-style file with coordinates for d2mbra1.
(The format of our PDB-style files is described here.)

Timeline for d2mbra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mbra2