Lineage for d2mbr_1 (2mbr 3-200)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36457Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 36458Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 36496Family d.145.1.2: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56184] (1 protein)
  6. 36497Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56185] (1 species)
  7. 36498Species Escherichia coli [TaxId:562] [56186] (4 PDB entries)
  8. 36500Domain d2mbr_1: 2mbr 3-200 [41749]
    Other proteins in same PDB: d2mbr_2

Details for d2mbr_1

PDB Entry: 2mbr (more details), 1.8 Å

PDB Description: murb wild type, complex with enolpyruvyl-udp-n-acetylglucosamine

SCOP Domain Sequences for d2mbr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mbr_1 d.145.1.2 (3-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli}
hslkpwntfgidhnaqhivcaedeqqllnawqyataegqpvlilgegsnvlfledyrgtv
iinrikgieihdepdawylhvgagenwhrlvkytlqegmpglenlalipgcvgsspiqni
gaygvelqrvcayvdsvelatgkqvrltakecrfgyrdsifkheyqdrfaivavglrlpk
ewqpvltygdltrldptt

SCOP Domain Coordinates for d2mbr_1:

Click to download the PDB-style file with coordinates for d2mbr_1.
(The format of our PDB-style files is described here.)

Timeline for d2mbr_1:

Domains from same chain:
(mouse over for more information)
d2mbr_2