PDB entry 2mbr

View 2mbr on RCSB PDB site
Description: murb wild type, complex with enolpyruvyl-udp-n-acetylglucosamine
Class: oxidoreductase
Keywords: peptidoglycan synthesis, cell wall, cell division, oxidoreductase, nadp, flavoprotein, fad
Deposited on 1996-11-08, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridine diphospho-n-acetylenolpyruvylglucosamine reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mbra1, d2mbra2
  • Heterogens: FAD, EPU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mbrA (A:)
    hslkpwntfgidhnaqhivcaedeqqllnawqyataegqpvlilgegsnvlfledyrgtv
    iinrikgieihdepdawylhvgagenwhrlvkytlqegmpglenlalipgcvgsspiqni
    gaygvelqrvcayvdsvelatgkqvrltakecrfgyrdsifkheyqdrfaivavglrlpk
    ewqpvltygdltrldpttvtpqqvfnavchmrttklpdpkvngnagsffknpvvsaetak
    allsqfptapnypqadgsvklaagwlidqcqlkgmqiggaavhrqqalvlinednaksed
    vvqlahhvrqkvgekfnvwlepevrfigasgevsavetis