SCOPe 2.08: Domain d6xp6b2: 6xp6 B:93-190

Lineage for d6xp6b2 (6xp6 B:93-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6xp6b2: 6xp6 B:93-190 [417104]
   Other proteins in same PDB: d6xp6a1, d6xp6a2, d6xp6b1, d6xp6d1, d6xp6d2, d6xp6e1
   automated match to d1sebb1
   complexed with cl, ipa, nag

Details for d6xp6b2

PDB Entry: 6xp6, 2.4 Å

PDB Description: 3c11-dq2-glia-a2 complex

PDB Compounds: (B:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d6xp6b2:

Sequence, based on SEQRES records:

>d6xp6b2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqspitvewra

Sequence, based on observed residues (ATOM records):

>d6xp6b2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilvm
lemtpqrgdvytchvehpslqspitvewra

Timeline for d6xp6b2:

• d6xp6b2 is new in SCOPe 2.08-stable