| Root: SCOPe 2.08 |
| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
| Protein automated matches [190205] (35 species) not a true protein |
| Species Chromobacterium violaceum [TaxId:243365] [419912] (1 PDB entry) |
| Domain d4lgqd_: 4lgq D: [413916] automated match to d6hnne_ complexed with cl, edo, peg, pg4 |
PDB Entry: 4lgq (more details), 2.72 Å
SCOPe Domain Sequences for d4lgqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lgqd_ d.17.4.0 (D:) automated matches {Chromobacterium violaceum [TaxId: 243365]}
mdtskaviqrfnreviengdmaafaelvapdfvnhsappgvspgpdgfagfftgmlhpal
sdirvhiheqieengkvvtrktieathtgaffgqpasgkriaihamdivvvrdgkyaehw
scadlygalaqira
Timeline for d4lgqd_: