Lineage for d4lgqb_ (4lgq B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937199Species Chromobacterium violaceum [TaxId:243365] [419912] (1 PDB entry)
  8. 2937201Domain d4lgqb_: 4lgq B: [413914]
    automated match to d6hnne_
    complexed with cl, edo, peg, pg4

Details for d4lgqb_

PDB Entry: 4lgq (more details), 2.72 Å

PDB Description: crystal structure of a putative polyketide cyclase (cv_0247) from chromobacterium violaceum atcc 12472 at 2.72 a resolution
PDB Compounds: (B:) Putative polyketide cyclase

SCOPe Domain Sequences for d4lgqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lgqb_ d.17.4.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 243365]}
mdtskaviqrfnreviengdmaafaelvapdfvnhsappgvspgpdgfagfftgmlhpal
sdirvhiheqieengkvvtrktieathtgaffgqpasgkriaihamdivvvrdgkyaehw
scadlygalaqira

SCOPe Domain Coordinates for d4lgqb_:

Click to download the PDB-style file with coordinates for d4lgqb_.
(The format of our PDB-style files is described here.)

Timeline for d4lgqb_:

  • d4lgqb_ is new in SCOPe 2.08-stable