Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d7nx6h_: 7nx6 H: [412647] Other proteins in same PDB: d7nx6b2, d7nx6e_, d7nx6l1, d7nx6l2 automated match to d6shgh_ complexed with cl, gol, nag, so4 |
PDB Entry: 7nx6 (more details), 2.25 Å
SCOPe Domain Sequences for d7nx6h_:
Sequence, based on SEQRES records: (download)
>d7nx6h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesgggvvqpgrslrlscaasaftfssydmhwvrqapgkglewvavisydgsnkyy adsvkgrftisrdnskntlylqmnslraedtavyycakdggklwvyyfdywgqgtlvtvs sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
>d7nx6h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesgggvvqpgrslrlscaasaftfssydmhwvrqapgkglewvavisydgsnkyy adsvkgrftisrdnskntlylqmnslraedtavyycakdggklwvyyfdywgqgtlvtvs sastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl ssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
Timeline for d7nx6h_: