Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end |
Family a.29.12.0: automated matches [254298] (1 protein) not a true family |
Protein automated matches [254684] (5 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [420086] (15 PDB entries) |
Domain d6zkj13: 6zkj 1:340-438 [412297] Other proteins in same PDB: d6zkj11, d6zkj12, d6zkjg_, d6zkjj_, d6zkjx_ automated match to d6ztqf3 complexed with 3pe, amp, cdl, dcq, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn |
PDB Entry: 6zkj (more details), 3 Å
SCOPe Domain Sequences for d6zkj13:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zkj13 a.29.12.0 (1:340-438) automated matches {Sheep (Ovis aries) [TaxId: 9940]} stdivkaiarliefykhescgqctpcregvdwmnkvmarfvrgdarpaeidslweiskqi eghticalgdgaawpvqglirhfrpeleermqrfaqqhq
Timeline for d6zkj13: