SCOPe 2.08: Domain d6nala2: 6nal A:366-475

Lineage for d6nala2 (6nal A:366-475)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.183: Perfringolysin C-terminal-like [418707] (1 superfamily)
   all-beta, similar to the CalB domain fold (b.7) but the two last strands are transposed

4. Superfamily b.183.1: Perfringolysin C-terminal-like [418736] (1 family)

5. Family b.183.1.1: Perfringolysin C-terminal-like [418784] (8 proteins)

6. Protein Desulfobulbus propionicus cytolysin C-terminal domain [419179] (1 species)

7. Species Desulfobulbus propionicus (strain ATCC 33891 / DSM 2032 / 1pr3) [TaxId:577650] [419290] (1 PDB entry)

8. Domain d6nala2: 6nal A:366-475 [411509]
   Other proteins in same PDB: d6nala1, d6nalb1
   complexed with imd, pg4

Details for d6nala2

PDB Entry: 6nal, 2.3 Å

PDB Description: crystal structure of gram negative toxin

PDB Compounds: (A:) Thiol-activated cytolysin

SCOPe Domain Sequences for d6nala2:

Sequence; same for both SEQRES and ATOM records:

>d6nala2 b.183.1.1 (A:366-475) Desulfobulbus propionicus cytolysin C-terminal domain {Desulfobulbus propionicus (strain ATCC 33891 / DSM 2032 / 1pr3) [TaxId: 577650]}
ggeirlehsgwyvarftvtwdeisyenglkvirhkgwegngkdrtapfsttiplrgnarn
isiktegctglawewwrtsgykvgralvplrtvsiggttlhqtfsmtpad

Timeline for d6nala2:

• d6nala2 is new in SCOPe 2.08-stable