Lineage for d6nalb1 (6nal B:3-365)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029423Fold f.69: Perfringolysin N-terminal-like [418706] (1 superfamily)
    twisted 4-strand antiparallel beta sheet, surrounded by other helices and strands, complex topology
  4. 3029424Superfamily f.69.1: Perfringolysin N-terminal-like [418735] (2 families) (S)
  5. 3029425Family f.69.1.1: Perfringolysin N-terminal-like [418783] (9 proteins)
  6. 3029430Protein Desulfobulbus propionicus cytolysin N-terminal domain [419178] (1 species)
  7. 3029431Species Desulfobulbus propionicus (strain ATCC 33891 / DSM 2032 / 1pr3) [TaxId:577650] [419289] (1 PDB entry)
  8. 3029433Domain d6nalb1: 6nal B:3-365 [411510]
    Other proteins in same PDB: d6nala2, d6nalb2
    complexed with imd, pg4

Details for d6nalb1

PDB Entry: 6nal (more details), 2.3 Å

PDB Description: crystal structure of gram negative toxin
PDB Compounds: (B:) Thiol-activated cytolysin

SCOPe Domain Sequences for d6nalb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nalb1 f.69.1.1 (B:3-365) Desulfobulbus propionicus cytolysin N-terminal domain {Desulfobulbus propionicus (strain ATCC 33891 / DSM 2032 / 1pr3) [TaxId: 577650]}
nnralindklaslqynpktvmvfngtsisnidlpaeerfddstyivmtrekcsyeadfdi
avpsayedvtypgallvasndlldgkpqelavdkdrvnitvdlpgatdisfkvvptfanv
ragindilskwfdshggewslpanfqyssslvydenelmlkfgcdisylkqklsidfsst
raekksvylirfkqifysvsaerpakpadifaesttwedlaragiseehpplfvknvqyg
rqiflkfesklsstelettikgtcskdglkidanasaalkeklsqidvsivvhggseavy
nglslnsmddvqkinriiwdntllsrtntaaplnyytvflkdgvsagvhgtteyvaekte
rys

SCOPe Domain Coordinates for d6nalb1:

Click to download the PDB-style file with coordinates for d6nalb1.
(The format of our PDB-style files is described here.)

Timeline for d6nalb1:

  • d6nalb1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6nalb2