Lineage for d1chmb2 (1chm B:157-402)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137310Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
  4. 137311Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 137312Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 137318Protein Creatinase, catalytic (C-terminal) domain [55922] (1 species)
  7. 137319Species Pseudomonas putida [TaxId:303] [55923] (1 PDB entry)
  8. 137321Domain d1chmb2: 1chm B:157-402 [41143]
    Other proteins in same PDB: d1chma1, d1chmb1

Details for d1chmb2

PDB Entry: 1chm (more details), 1.9 Å

PDB Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures

SCOP Domain Sequences for d1chmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chmb2 d.127.1.1 (B:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida}
miksaeehvmirhgariadiggaavvealgdqvpeyevalhatqamvraiadtfedvelm
dtwtwfqsgintdgahnpvttrkvnkgdilslncfpmiagyytalertlfldhcsddhlr
lwqvnvevheaglklikpgarcsdiarelneiflkhdvlqyrtfgyghsfgtlshyygre
aglelredidtvlepgmvvsmepmimlpeglpgaggyrehdilivnengaenitkfpygp
ekniir

SCOP Domain Coordinates for d1chmb2:

Click to download the PDB-style file with coordinates for d1chmb2.
(The format of our PDB-style files is described here.)

Timeline for d1chmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1chmb1