SCOP 1.61: Domain d1chmb2: 1chm B:157-402

Lineage for d1chmb2 (1chm B:157-402)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Creatinase, catalytic (C-terminal) domain [55922] (2 species)

7. Species Pseudomonas putida [TaxId:303] [55923] (1 PDB entry)

8. Domain d1chmb2: 1chm B:157-402 [41143]
   Other proteins in same PDB: d1chma1, d1chmb1

Details for d1chmb2

PDB Entry: 1chm, 1.9 Å

PDB Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures

SCOP Domain Sequences for d1chmb2:

Sequence; same for both SEQRES and ATOM records:

>d1chmb2 d.127.1.1 (B:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida}
miksaeehvmirhgariadiggaavvealgdqvpeyevalhatqamvraiadtfedvelm
dtwtwfqsgintdgahnpvttrkvnkgdilslncfpmiagyytalertlfldhcsddhlr
lwqvnvevheaglklikpgarcsdiarelneiflkhdvlqyrtfgyghsfgtlshyygre
aglelredidtvlepgmvvsmepmimlpeglpgaggyrehdilivnengaenitkfpygp
ekniir

Timeline for d1chmb2:

• d1chmb2 first appeared (with stable ids) in SCOP 1.55
  
• d1chmb2 appears in SCOP 1.59
  
• d1chmb2 appears in SCOP 1.63
  
• d1chmb2 appears in the current release, SCOPe 2.08