| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d6jeph_: 6jep H: [411336] Other proteins in same PDB: d6jepe_, d6jepf_ automated match to d6shgh_ |
PDB Entry: 6jep (more details), 2.32 Å
SCOPe Domain Sequences for d6jeph_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jeph_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgasvkvsckasgytftsghtfpsydinwvrqatgqglewmgwmnpn
rgntgyaqkfqgrvtmtrntsintaymelsslrsedtavyycarvrsgtnygsyyyyyyg
mdvwgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgal
tsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk
Timeline for d6jeph_: