SCOPe 2.08: Domain d6a4kj1: 6a4k J:6-230

Lineage for d6a4kj1 (6a4k J:6-230)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (31 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
Domain d6a4kj1: 6a4k J:6-230 [410777]
Other proteins in same PDB: d6a4kh2, d6a4ki2, d6a4kj2, d6a4kk2, d6a4kl2, d6a4km2, d6a4kn2, d6a4ko2
automated match to d6shgh_
complexed with act, ca, nag

Details for d6a4kj1

PDB Entry: 6a4k (more details), 3.15 Å

PDB Description: human antibody 32d6 fab in complex with h1n1 influenza a virus ha1

PDB Compounds: (J:) Immunoglobulin Fab heavy chain

SCOPe Domain Sequences for d6a4kj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a4kj1 b.1.1.0 (J:6-230) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsvntgsyywswirqppgkglewiayssvsgtsnynpsl
ksrvtltvdtsknqfslsvrsvtaadtavyfcarlnydiltgyyffdfwgqgtlvivssa
stkgpsvfplapssksasggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssssgtqtyicnvnhkpsntkvdkrvepkscdkt

SCOPe Domain Coordinates for d6a4kj1:

Click to download the PDB-style file with coordinates for d6a4kj1.
(The format of our PDB-style files is described here.)

Timeline for d6a4kj1: