Lineage for d5diid1 (5dii D:4-114)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2956023Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2956024Protein automated matches [195117] (13 species)
    not a true protein
  7. 2956071Species Haliangium ochraceum [TaxId:502025] [279894] (3 PDB entries)
  8. 2956074Domain d5diid1: 5dii D:4-114 [409960]
    automated match to d5dihd1
    complexed with sf4

Details for d5diid1

PDB Entry: 5dii (more details), 1.8 Å

PDB Description: structure of an engineered bacterial microcompartment shell protein binding a [4fe-4s] cluster
PDB Compounds: (D:) Microcompartments protein

SCOPe Domain Sequences for d5diid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5diid1 d.58.56.0 (D:4-114) automated matches {Haliangium ochraceum [TaxId: 502025]}
aperfdatppagepdrpalgvleltsiargitvadaalkrapslllmsrpvcsgkhllmm
rgqvaeveesmiaareiagagsgalldelelpyaheqlwrfldapvvadaw

SCOPe Domain Coordinates for d5diid1:

Click to download the PDB-style file with coordinates for d5diid1.
(The format of our PDB-style files is described here.)

Timeline for d5diid1:

  • d5diid1 is new in SCOPe 2.08-stable