Lineage for d4z5rq_ (4z5r Q:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743580Domain d4z5rq_: 4z5r Q: [409745]
    Other proteins in same PDB: d4z5ra1, d4z5ra2, d4z5rd_, d4z5re_, d4z5rf_, d4z5rg_, d4z5rh_, d4z5ri_, d4z5rj1, d4z5rj2, d4z5rl1, d4z5rl2, d4z5rn_, d4z5rp1, d4z5rp2, d4z5rr1, d4z5rr2, d4z5rt1, d4z5rt2, d4z5rv1, d4z5rv2, d4z5rx_, d4z5ry_
    automated match to d6shgh_
    complexed with so4

Details for d4z5rq_

PDB Entry: 4z5r (more details), 3 Å

PDB Description: rontalizumab fab bound to interferon-a2
PDB Compounds: (Q:) anti-IFN-a antibody rontalizumab heavy chain modules VH and CH1 (Fab)

SCOPe Domain Sequences for d4z5rq_:

Sequence, based on SEQRES records: (download)

>d4z5rq_ b.1.1.1 (Q:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscatsgytfteyiihwvrqapgkglewvasinpdyditny
nqrfkgrftisldkskrtaylqmnslraedtavyycaswisdffdywgqgtlvtvssast
kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d4z5rq_ b.1.1.1 (Q:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscatsgytfteyiihwvrqapgkglewvasinpdyditny
nqrfkgrftisldkskrtaylqmnslraedtavyycaswisdffdywgqgtlvtvssast
kgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d4z5rq_:

Click to download the PDB-style file with coordinates for d4z5rq_.
(The format of our PDB-style files is described here.)

Timeline for d4z5rq_:

  • d4z5rq_ is new in SCOPe 2.08-stable