Lineage for d4wfhg_ (4wfh G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745161Domain d4wfhg_: 4wfh G: [409626]
    Other proteins in same PDB: d4wfhd1, d4wfhd2, d4wfhf1, d4wfhf2
    automated match to d6shgh_
    complexed with ca, d10, tl

Details for d4wfhg_

PDB Entry: 4wfh (more details), 3.01 Å

PDB Description: Human TRAAK K+ channel in a Tl+ bound nonconductive conformation
PDB Compounds: (G:) anti-traak antibody 13e9 fab fragment heavy chain

SCOPe Domain Sequences for d4wfhg_:

Sequence, based on SEQRES records: (download)

>d4wfhg_ b.1.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasmktsckvsgysftgyimnwvkqrhgknlewiglinpntgytty
nqkfkgkatltvdkssstaymellsltsedsaiyyctrgnyvfdywgqgttltvssaktt
ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpssswpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d4wfhg_ b.1.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasmktsckvsgysftgyimnwvkqrhgknlewiglinpntgytty
nqkfkgkatltvdkssstaymellsltsedsaiyyctrgnyvfdywgqgttltvssaktt
ppsvyplapnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
pssswpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d4wfhg_:

Click to download the PDB-style file with coordinates for d4wfhg_.
(The format of our PDB-style files is described here.)

Timeline for d4wfhg_:

  • d4wfhg_ is new in SCOPe 2.08-stable