Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mus musculus, homo [TaxId:10090] [419904] (2 PDB entries) |
Domain d4gw5b_: 4gw5 B: [408969] Other proteins in same PDB: d4gw5a2, d4gw5c2 automated match to d6shgh_ complexed with po4 |
PDB Entry: 4gw5 (more details), 2.2 Å
SCOPe Domain Sequences for d4gw5b_:
Sequence, based on SEQRES records: (download)
>d4gw5b_ b.1.1.0 (B:) automated matches {Mus musculus, homo [TaxId: 10090]} qvqlkqsgpglvqpsqslsitctvsgfsltnygvhwvrqspgkglewlgviwsggntdyn tpftsrlsinkdnsksqvffkmnslqsndtaiyycaraltyydyefaywgqgtlvtvsaa stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk
>d4gw5b_ b.1.1.0 (B:) automated matches {Mus musculus, homo [TaxId: 10090]} qvqlkqsgpglvqpsqslsitctvsgfsltnygvhwvrqspgkglewlgviwsggntdyn tpftsrlsinkdnsksqvffkmnslqsndtaiyycaraltyydyefaywgqgtlvtvsaa stkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl ssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk
Timeline for d4gw5b_: