| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
| Domain d3u30f_: 3u30 F: [408705] Other proteins in same PDB: d3u30a1, d3u30a2, d3u30a3, d3u30b1, d3u30b2, d3u30d1, d3u30d2, d3u30e1, d3u30e2 automated match to d6shgh_ |
PDB Entry: 3u30 (more details), 2.43 Å
SCOPe Domain Sequences for d3u30f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u30f_ b.1.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfsntyiswvrqapgkglewvasitpssgqtdya
dsvkgrftisadtskntaylqmnslraedtavyycartwllrwvmdlwgqgtlvtvssas
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d3u30f_: