Lineage for d3mlwi_ (3mlw I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758814Domain d3mlwi_: 3mlw I: [408493]
    Other proteins in same PDB: d3mlwl1, d3mlwl2, d3mlwm1, d3mlwm2
    automated match to d6shgh_
    complexed with po4

Details for d3mlwi_

PDB Entry: 3mlw (more details), 2.7 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 1006-15d in complex with an mn v3 peptide
PDB Compounds: (I:) Human monoclonal anti-HIV-1 gp120 V3 antibody 1006-15D Fab heavy chain

SCOPe Domain Sequences for d3mlwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mlwi_ b.1.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkagesleisckgsgytftdhwiawvrqvpgkglewmgmiypgdsdtry
spslqgrvtmsadktlstaylqwsrleasdtamyycarlhysdrsgsyfndvfhmwgqgt
tvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfp
avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d3mlwi_:

Click to download the PDB-style file with coordinates for d3mlwi_.
(The format of our PDB-style files is described here.)

Timeline for d3mlwi_:

  • d3mlwi_ is new in SCOPe 2.08-stable