SCOP 1.59: Domain d1jem__: 1jem -

Lineage for d1jem__ (1jem -)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.94: HPr-like [55593] (1 superfamily)

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species)

7. Species Bacillus subtilis [TaxId:1423] [55597] (4 PDB entries)

8. Domain d1jem__: 1jem - [40548]

Details for d1jem__

PDB Entry: 1jem

PDB Description: nmr structure of histidine phosphorylated form of the phosphocarrier histidine containing protein from bacillus subtilis, nmr, 25 structures

SCOP Domain Sequences for d1jem__:

Sequence; same for both SEQRES and ATOM records:

>d1jem__ d.94.1.1 (-) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis}
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvvslgiakgaei
tisasgadendalnaleetmkseglge

Timeline for d1jem__:

• d1jem__ first appeared (with stable ids) in SCOP 1.55
  
• d1jem__ appears in SCOP 1.57
  
• d1jem__ appears in SCOP 1.61
  
• d1jem__ appears in the current release, SCOPe 2.08, called d1jema_