PDB entry 1jem

View 1jem on RCSB PDB site
Description: nmr structure of histidine phosphorylated form of the phosphocarrier histidine containing protein from bacillus subtilis, nmr, 25 structures
Deposited on 1997-04-01, released 1997-07-23
The last revision prior to the SCOP 1.59 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1jem__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jem_ (-)
  aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvvslgiakgaei
  tisasgadendalnaleetmkseglge