Lineage for d1jem__ (1jem -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) 
Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) 
Species Bacillus subtilis [TaxId:1423] [55597] (4 PDB entries) 
Domain d1jem__: 1jem - [40548]
Details for d1jem__
PDB Entry: 1jem (more details)
PDB Description: nmr structure of histidine phosphorylated form of the phosphocarrier histidine containing protein from bacillus subtilis, nmr, 25 structures
SCOP Domain Sequences for d1jem__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jem__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Bacillus subtilis}
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvvslgiakgaei
tisasgadendalnaleetmkseglge
SCOP Domain Coordinates for d1jem__:
Click to download the PDB-style file with coordinates for d1jem__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jem__:
- d1jem__ appears in SCOP 1.57
- d1jem__ appears in the current release, SCOPe 2.08, called d1jema_
View in 3D