Lineage for d1spha_ (1sph A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136161Fold d.94: HPr-like [55593] (1 superfamily)
  4. 136162Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 136163Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 136167Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species)
  7. 136168Species Bacillus subtilis [TaxId:1423] [55597] (4 PDB entries)
  8. 136169Domain d1spha_: 1sph A: [40544]

Details for d1spha_

PDB Entry: 1sph (more details), 2 Å

PDB Description: refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition

SCOP Domain Sequences for d1spha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spha_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis}
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgaei
tisasgadendalnaleetmkseglge

SCOP Domain Coordinates for d1spha_:

Click to download the PDB-style file with coordinates for d1spha_.
(The format of our PDB-style files is described here.)

Timeline for d1spha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sphb_