![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.94: HPr-like [55593] (1 superfamily) |
![]() | Superfamily d.94.1: HPr-like [55594] (1 family) ![]() |
![]() | Family d.94.1.1: HPr-like [55595] (2 proteins) |
![]() | Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [55597] (4 PDB entries) |
![]() | Domain d1spha_: 1sph A: [40544] |
PDB Entry: 1sph (more details), 2 Å
SCOP Domain Sequences for d1spha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1spha_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis} aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgaei tisasgadendalnaleetmkseglge
Timeline for d1spha_: