SCOP 1.57: Domain d1spha_: 1sph A:

Lineage for d1spha_ (1sph A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily)

4. Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family)

5. Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein)

6. Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species)

7. Species Bacillus subtilis [TaxId:1423] [55597] (4 PDB entries)

8. Domain d1spha_: 1sph A: [40544]

Details for d1spha_

PDB Entry: 1sph, 2 Å

PDB Description: refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition

SCOP Domain Sequences for d1spha_:

Sequence; same for both SEQRES and ATOM records:

>d1spha_ d.94.1.1 (A:) Histidine-containing phosphocarrier proteins (HPr) {Bacillus subtilis}
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgaei
tisasgadendalnaleetmkseglge

Timeline for d1spha_:

• d1spha_ first appeared (with stable ids) in SCOP 1.55
  
• d1spha_ appears in SCOP 1.59
  
• d1spha_ appears in the current release, SCOPe 2.08