PDB entry 1sph

View 1sph on RCSB PDB site
Description: refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition
Deposited on 1994-11-03, released 1995-02-07
The last revision prior to the SCOP 1.57 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2 Å
R-factor: 0.143
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1spha_
  • Chain 'B':
    Domains in SCOP 1.57: d1sphb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sphA (A:)
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgaei
tisasgadendalnaleetmkseglge

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sphB (B:)
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgaei
tisasgadendalnaleetmkseglge