SCOPe 2.07: Domain d7ce6a2: 7ce6 A:246-437

Lineage for d7ce6a2 (7ce6 A:246-437)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)

Domain d7ce6a2: 7ce6 A:246-437 [404620]
Other proteins in same PDB: d7ce6a1, d7ce6b1, d7ce6c1, d7ce6d1, d7ce6e_, d7ce6f1, d7ce6f2, d7ce6f3
automated match to d4i50a2
complexed with acp, af6, ca, gdp, gol, gtp, mes, mg

Details for d7ce6a2

PDB Entry: 7ce6 (more details), 2.7 Å

PDB Description: crystal structure of t2r-ttl-compound9 complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d7ce6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ce6a2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d7ce6a2:

Click to download the PDB-style file with coordinates for d7ce6a2.
(The format of our PDB-style files is described here.)

Timeline for d7ce6a2: