Lineage for d7ce6f1 (7ce6 F:1-76)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470419Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2470420Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2470421Species Chicken (Gallus gallus) [TaxId:9031] [311384] (170 PDB entries)
  8. 2470522Domain d7ce6f1: 7ce6 F:1-76 [404540]
    Other proteins in same PDB: d7ce6a1, d7ce6a2, d7ce6b1, d7ce6b2, d7ce6c1, d7ce6c2, d7ce6d1, d7ce6d2, d7ce6e_, d7ce6f2, d7ce6f3
    automated match to d3tiia1
    complexed with acp, af6, ca, gdp, gol, gtp, mes, mg

Details for d7ce6f1

PDB Entry: 7ce6 (more details), 2.7 Å

PDB Description: crystal structure of t2r-ttl-compound9 complex
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d7ce6f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ce6f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d7ce6f1:

Click to download the PDB-style file with coordinates for d7ce6f1.
(The format of our PDB-style files is described here.)

Timeline for d7ce6f1: