Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (158 PDB entries) |
Domain d7ce6f2: 7ce6 F:77-378 [404541] Other proteins in same PDB: d7ce6a1, d7ce6a2, d7ce6b1, d7ce6b2, d7ce6c1, d7ce6c2, d7ce6d1, d7ce6d2, d7ce6e_, d7ce6f1, d7ce6f3 automated match to d3tiia2 complexed with acp, af6, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 7ce6 (more details), 2.7 Å
SCOPe Domain Sequences for d7ce6f2:
Sequence, based on SEQRES records: (download)
>d7ce6f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d7ce6f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwialisseasel ldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepyn sanfqdktchltnhciqknygryeegnemffeefnqylmdalnttlensillqikhiirs clmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdv aissvfplatsifikl
Timeline for d7ce6f2: