SCOPe 2.07: Domain d7ce6c1: 7ce6 C:1-245

Lineage for d7ce6c1 (7ce6 C:1-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)

8. Domain d7ce6c1: 7ce6 C:1-245 [404617]
   Other proteins in same PDB: d7ce6a2, d7ce6b2, d7ce6c2, d7ce6d2, d7ce6e_, d7ce6f1, d7ce6f2, d7ce6f3
   automated match to d5fnva1
   complexed with acp, af6, ca, gdp, gol, gtp, mes, mg

Details for d7ce6c1

PDB Entry: 7ce6, 2.7 Å

PDB Description: crystal structure of t2r-ttl-compound9 complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d7ce6c1:

Sequence; same for both SEQRES and ATOM records:

>d7ce6c1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d7ce6c1:

• d7ce6c1 is new in SCOPe 2.07-stable
  
• d7ce6c1 appears in the current release, SCOPe 2.08