SCOP 1.59: Domain d1bhhb_: 1bhh B:

Lineage for d1bhhb_ (1bhh B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein p56-lck tyrosine kinase [55552] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55553] (9 PDB entries)

8. Domain d1bhhb_: 1bhh B: [40417]

Details for d1bhhb_

PDB Entry: 1bhh, 1.9 Å

PDB Description: free p56lck sh2 domain

SCOP Domain Sequences for d1bhhb_:

Sequence; same for both SEQRES and ATOM records:

>d1bhhb_ d.93.1.1 (B:) p56-lck tyrosine kinase {Human (Homo sapiens)}
pepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyki
rnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

Timeline for d1bhhb_:

• d1bhhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bhhb_ appears in SCOP 1.57
  
• d1bhhb_ appears in SCOP 1.61
  
• d1bhhb_ appears in the current release, SCOPe 2.08