SCOP 1.59: Domain d1bhha_: 1bhh A:

Lineage for d1bhha_ (1bhh A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein p56-lck tyrosine kinase [55552] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55553] (9 PDB entries)

8. Domain d1bhha_: 1bhh A: [40416]

Details for d1bhha_

PDB Entry: 1bhh, 1.9 Å

PDB Description: free p56lck sh2 domain

SCOP Domain Sequences for d1bhha_:

Sequence; same for both SEQRES and ATOM records:

>d1bhha_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens)}
epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

Timeline for d1bhha_:

• d1bhha_ first appeared (with stable ids) in SCOP 1.55
  
• d1bhha_ appears in SCOP 1.57
  
• d1bhha_ appears in SCOP 1.61
  
• d1bhha_ appears in the current release, SCOPe 2.08