Lineage for d1bhha_ (1bhh A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 136057Protein p56-lck tyrosine kinase [55552] (1 species)
  7. 136058Species Human (Homo sapiens) [TaxId:9606] [55553] (9 PDB entries)
  8. 136063Domain d1bhha_: 1bhh A: [40416]

Details for d1bhha_

PDB Entry: 1bhh (more details), 1.9 Å

PDB Description: free p56lck sh2 domain

SCOP Domain Sequences for d1bhha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhha_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens)}
epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOP Domain Coordinates for d1bhha_:

Click to download the PDB-style file with coordinates for d1bhha_.
(The format of our PDB-style files is described here.)

Timeline for d1bhha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bhhb_