Lineage for d1bhhb_ (1bhh B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34602Protein p56-lck tyrosine kinase [55552] (1 species)
  7. 34603Species Human (Homo sapiens) [TaxId:9606] [55553] (9 PDB entries)
  8. 34609Domain d1bhhb_: 1bhh B: [40417]

Details for d1bhhb_

PDB Entry: 1bhh (more details), 1.9 Å

PDB Description: free p56lck sh2 domain

SCOP Domain Sequences for d1bhhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhhb_ d.93.1.1 (B:) p56-lck tyrosine kinase {Human (Homo sapiens)}
pepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyki
rnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOP Domain Coordinates for d1bhhb_:

Click to download the PDB-style file with coordinates for d1bhhb_.
(The format of our PDB-style files is described here.)

Timeline for d1bhhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bhha_