Lineage for d7ly2g_ (7ly2 G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742695Domain d7ly2g_: 7ly2 G: [403552]
    Other proteins in same PDB: d7ly2c_, d7ly2d_, d7ly2e_, d7ly2f_, d7ly2i_, d7ly2k_, d7ly2l_, d7ly2m_, d7ly2o_
    automated match to d5gs1b_
    complexed with bma, fuc, nag

Details for d7ly2g_

PDB Entry: 7ly2 (more details), 2.5 Å

PDB Description: sars-cov-2 s/s2m11/s2m28 global refinement
PDB Compounds: (G:) S2M28 Fab Heavy Chain variable region

SCOPe Domain Sequences for d7ly2g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ly2g_ b.1.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesgggvvqpgrslrlscaasgftfssygmhwvrqapgkglewvtviwydgsnryya
dsvkgrftisrdnskntlylqmdslraedtavyycaravagewyfdywgqgtlvtvs

SCOPe Domain Coordinates for d7ly2g_:

Click to download the PDB-style file with coordinates for d7ly2g_.
(The format of our PDB-style files is described here.)

Timeline for d7ly2g_: