SCOPe 2.08: Domain d7ls5j_: 7ls5 J:

Lineage for d7ls5j_ (7ls5 J:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d7ls5j_: 7ls5 J: [403502]
   Other proteins in same PDB: d7ls5a_, d7ls5b_, d7ls5c_, d7ls5d1, d7ls5d2, d7ls5e_, d7ls5f_, d7ls5g_, d7ls5h_, d7ls5k_, d7ls5l_, d7ls5o_, d7ls5p_, d7ls5q_, d7ls5r1, d7ls5r2, d7ls5s_, d7ls5t_, d7ls5u_, d7ls5v_, d7ls5y_, d7ls5z_
   automated match to d1g0ui_

Details for d7ls5j_

PDB Entry: 7ls5, 2.74 Å

PDB Description: cryo-em structure of the pre3-1 20s proteasome core particle

PDB Compounds: (J:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d7ls5j_:

Sequence; same for both SEQRES and ATOM records:

>d7ls5j_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d7ls5j_:

• d7ls5j_ first appeared in SCOPe 2.07