SCOPe 2.08: Domain d7ll3a1: 7ll3 A:1-97

Lineage for d7ll3a1 (7ll3 A:1-97)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:1268998] [402216] (5 PDB entries)

8. Domain d7ll3a1: 7ll3 A:1-97 [402263]
   Other proteins in same PDB: d7ll3a3, d7ll3b3
   automated match to d1mxaa1
   complexed with edo, mg, ppk, unp

Details for d7ll3a1

PDB Entry: 7ll3, 2.24 Å

PDB Description: s-adenosylmethionine synthetase co-crystallized with uppnhp

PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d7ll3a1:

Sequence; same for both SEQRES and ATOM records:

>d7ll3a1 d.130.1.0 (A:1-97) automated matches {Escherichia coli [TaxId: 1268998]}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigk

Timeline for d7ll3a1:

• d7ll3a1 first appeared in SCOPe 2.07