SCOPe 2.08: Domain d7ll3a3: 7ll3 A:232-382

Lineage for d7ll3a3 (7ll3 A:232-382)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)

6. Protein automated matches [402219] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:1268998] [402220] (5 PDB entries)

8. Domain d7ll3a3: 7ll3 A:232-382 [402265]
   Other proteins in same PDB: d7ll3a1, d7ll3a2, d7ll3b1, d7ll3b2
   automated match to d1mxaa3
   complexed with edo, mg, ppk, unp

Details for d7ll3a3

PDB Entry: 7ll3, 2.24 Å

PDB Description: s-adenosylmethionine synthetase co-crystallized with uppnhp

PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d7ll3a3:

Sequence; same for both SEQRES and ATOM records:

>d7ll3a3 d.130.1.1 (A:232-382) automated matches {Escherichia coli [TaxId: 1268998]}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaagl

Timeline for d7ll3a3:

• d7ll3a3 first appeared in SCOPe 2.07