Lineage for d7kyly1 (7kyl Y:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759774Domain d7kyly1: 7kyl Y:1-106 [402240]
    Other proteins in same PDB: d7kyle_, d7kylh_, d7kyll2, d7kylx_, d7kyly2, d7kylz_
    automated match to d1gm3l1
    complexed with cl, na

Details for d7kyly1

PDB Entry: 7kyl (more details), 2 Å

PDB Description: powassan virus envelope protein diii in complex with neutralizing fab powv-80
PDB Compounds: (Y:) POWV-80 Fab light chain

SCOPe Domain Sequences for d7kyly1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kyly1 b.1.1.0 (Y:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eivltqspailsaspgekvtmtcrasssvsymhwyqqkpgsspkswiyatsnlasgvptr
fsgsgsgtsysltisrveaedaatyycqqrssnprtfgggtkleik

SCOPe Domain Coordinates for d7kyly1:

Click to download the PDB-style file with coordinates for d7kyly1.
(The format of our PDB-style files is described here.)

Timeline for d7kyly1: