Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries) |
Domain d6tu4c1: 6tu4 C:5-147 [400617] Other proteins in same PDB: d6tu4a2, d6tu4b2, d6tu4c2, d6tu4d2, d6tu4f2 automated match to d2btfa1 complexed with 9ue, adp, mg |
PDB Entry: 6tu4 (more details), 2.6 Å
SCOPe Domain Sequences for d6tu4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tu4c1 c.55.1.0 (C:5-147) automated matches {Plasmodium falciparum [TaxId: 36329]} dvqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdafvgdeaqtkrg iltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqim fesfnvpamyvaiqavlslyssg
Timeline for d6tu4c1: