Lineage for d6tu4d1 (6tu4 D:5-147)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493223Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)
  8. 2493306Domain d6tu4d1: 6tu4 D:5-147 [400601]
    Other proteins in same PDB: d6tu4a2, d6tu4b2, d6tu4c2, d6tu4d2, d6tu4f2
    automated match to d2btfa1
    complexed with 9ue, adp, mg

Details for d6tu4d1

PDB Entry: 6tu4 (more details), 2.6 Å

PDB Description: structure of plasmodium actin1 filament
PDB Compounds: (D:) Actin-1

SCOPe Domain Sequences for d6tu4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tu4d1 c.55.1.0 (D:5-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
dvqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdafvgdeaqtkrg
iltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqim
fesfnvpamyvaiqavlslyssg

SCOPe Domain Coordinates for d6tu4d1:

Click to download the PDB-style file with coordinates for d6tu4d1.
(The format of our PDB-style files is described here.)

Timeline for d6tu4d1: