SCOPe 2.07: Domain d6tu4a2: 6tu4 A:148-376

Lineage for d6tu4a2 (6tu4 A:148-376)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [336601] (11 PDB entries)

8. Domain d6tu4a2: 6tu4 A:148-376 [400614]
   Other proteins in same PDB: d6tu4a1, d6tu4b1, d6tu4c1, d6tu4d1, d6tu4f1
   automated match to d3ub5a2
   complexed with 9ue, adp, mg

Details for d6tu4a2

PDB Entry: 6tu4, 2.6 Å

PDB Description: structure of plasmodium actin1 filament

PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d6tu4a2:

Sequence; same for both SEQRES and ATOM records:

>d6tu4a2 c.55.1.1 (A:148-376) automated matches {Plasmodium falciparum [TaxId: 36329]}
rttgivldsgdgvshtvpiyegyalphaimrldlagrdlteylmkilhergygfstsaek
eivrdikeklcyialnfdeemktseqssdieksyelpdgniitvgnerfrcpealfqpsf
lgkeaagihtttfnsikkcdvdirkdlygnivlsggttmyegigerltrdittlapstmk
ikvvapperkysvwiggsilsslstfqqmwitkeeydesgpsivhrkcf

Timeline for d6tu4a2:

• d6tu4a2 is new in SCOPe 2.07-stable
  
• d6tu4a2 appears in the current release, SCOPe 2.08