| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [336601] (11 PDB entries) |
| Domain d6tu4a2: 6tu4 A:148-376 [400614] Other proteins in same PDB: d6tu4a1, d6tu4b1, d6tu4c1, d6tu4d1, d6tu4f1 automated match to d3ub5a2 complexed with 9ue, adp, mg |
PDB Entry: 6tu4 (more details), 2.6 Å
SCOPe Domain Sequences for d6tu4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tu4a2 c.55.1.1 (A:148-376) automated matches {Plasmodium falciparum [TaxId: 36329]}
rttgivldsgdgvshtvpiyegyalphaimrldlagrdlteylmkilhergygfstsaek
eivrdikeklcyialnfdeemktseqssdieksyelpdgniitvgnerfrcpealfqpsf
lgkeaagihtttfnsikkcdvdirkdlygnivlsggttmyegigerltrdittlapstmk
ikvvapperkysvwiggsilsslstfqqmwitkeeydesgpsivhrkcf
Timeline for d6tu4a2: