SCOPe 2.07: Domain d6tu4f1: 6tu4 F:5-147

Lineage for d6tu4f1 (6tu4 F:5-147)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)

8. Domain d6tu4f1: 6tu4 F:5-147 [400608]
   Other proteins in same PDB: d6tu4a2, d6tu4b2, d6tu4c2, d6tu4d2, d6tu4f2
   automated match to d2btfa1
   complexed with 9ue, adp, mg

Details for d6tu4f1

PDB Entry: 6tu4, 2.6 Å

PDB Description: structure of plasmodium actin1 filament

PDB Compounds: (F:) Actin-1

SCOPe Domain Sequences for d6tu4f1:

Sequence; same for both SEQRES and ATOM records:

>d6tu4f1 c.55.1.0 (F:5-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
dvqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdafvgdeaqtkrg
iltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqim
fesfnvpamyvaiqavlslyssg

Timeline for d6tu4f1:

• d6tu4f1 is new in SCOPe 2.07-stable
  
• d6tu4f1 appears in the current release, SCOPe 2.08