Lineage for d6lwtb2 (6lwt B:125-227)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934586Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2934587Protein automated matches [226841] (6 species)
    not a true protein
  7. 2934618Species Staphylococcus aureus [TaxId:93061] [226096] (8 PDB entries)
  8. 2934623Domain d6lwtb2: 6lwt B:125-227 [399870]
    Other proteins in same PDB: d6lwta1, d6lwta3, d6lwtb1, d6lwtb3
    automated match to d3r2ta2

Details for d6lwtb2

PDB Entry: 6lwt (more details), 1.9 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 10
PDB Compounds: (B:) Superantigen-like protein SSL10

SCOPe Domain Sequences for d6lwtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lwtb2 d.15.6.0 (B:125-227) automated matches {Staphylococcus aureus [TaxId: 93061]}
tsgvvsapilniskekgedafvkgypyyikkekitlkeldyklrkhliekyglyktiskd
grvkislkdgsfynldlrsklkfkymgevieskqikdievnlk

SCOPe Domain Coordinates for d6lwtb2:

Click to download the PDB-style file with coordinates for d6lwtb2.
(The format of our PDB-style files is described here.)

Timeline for d6lwtb2: