Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [226094] (8 PDB entries) |
Domain d6lwtb1: 6lwt B:41-124 [399869] Other proteins in same PDB: d6lwta2, d6lwta3, d6lwtb2, d6lwtb3 automated match to d3r2ta1 |
PDB Entry: 6lwt (more details), 1.9 Å
SCOPe Domain Sequences for d6lwtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lwtb1 b.40.2.0 (B:41-124) automated matches {Staphylococcus aureus [TaxId: 93061]} dkealyryytgktmemknisalkhgknnlrfkfrgikiqvllpgndkskfqqrsyegldv ffvqekrdkhdifytvggviqnnk
Timeline for d6lwtb1: