SCOPe 2.08: Domain d7aqab2: 7aqa B:508-638

Lineage for d7aqab2 (7aqa B:508-638)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries)

8. Domain d7aqab2: 7aqa B:508-638 [398331]
   Other proteins in same PDB: d7aqaa1, d7aqab1, d7aqab3
   automated match to d3sbqa2
   complexed with b3p, ca, cl, cua, fmt, k, k7e, na, phe, ruq; mutant

Details for d7aqab2

PDB Entry: 7aqa, 1.5 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase mutant, h382a

PDB Compounds: (B:) nitrous-oxide reductase

SCOPe Domain Sequences for d7aqab2:

Sequence; same for both SEQRES and ATOM records:

>d7aqab2 b.6.1.0 (B:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

Timeline for d7aqab2:

• d7aqab2 first appeared in SCOPe 2.07