Lineage for d7aqab2 (7aqa B:508-638)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382316Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries)
  8. 2382320Domain d7aqab2: 7aqa B:508-638 [398331]
    Other proteins in same PDB: d7aqaa1, d7aqab1, d7aqab3
    automated match to d3sbqa2
    complexed with b3p, ca, cl, cua, fmt, k, k7e, na, phe, ruq; mutant

Details for d7aqab2

PDB Entry: 7aqa (more details), 1.5 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase mutant, h382a
PDB Compounds: (B:) nitrous-oxide reductase

SCOPe Domain Sequences for d7aqab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7aqab2 b.6.1.0 (B:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

SCOPe Domain Coordinates for d7aqab2:

Click to download the PDB-style file with coordinates for d7aqab2.
(The format of our PDB-style files is described here.)

Timeline for d7aqab2: