SCOP 1.55: Domain d1b4ab2: 1b4a B:79-149

Lineage for d1b4ab2 (1b4a B:79-149)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family)

5. Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)

6. Protein C-terminal domain of arginine repressor [55254] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries)

8. Domain d1b4ab2: 1b4a B:79-149 [39722]
   Other proteins in same PDB: d1b4aa1, d1b4ab1, d1b4ac1, d1b4ad1, d1b4ae1, d1b4af1

Details for d1b4ab2

PDB Entry: 1b4a, 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus

SCOP Domain Sequences for d1b4ab2:

Sequence; same for both SEQRES and ATOM records:

>d1b4ab2 d.74.2.1 (B:79-149) C-terminal domain of arginine repressor {Bacillus stearothermophilus}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml

Timeline for d1b4ab2:

• d1b4ab2 appears in SCOP 1.57
  
• d1b4ab2 appears in the current release, SCOPe 2.08