| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.74: DCoH-like [55247] (4 superfamilies) |
Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family) ![]() |
| Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein) |
| Protein C-terminal domain of arginine repressor [55254] (2 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries) |
| Domain d1b4ac2: 1b4a C:79-149 [39723] Other proteins in same PDB: d1b4aa1, d1b4ab1, d1b4ac1, d1b4ad1, d1b4ae1, d1b4af1 |
PDB Entry: 1b4a (more details), 2.5 Å
SCOP Domain Sequences for d1b4ac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4ac2 d.74.2.1 (C:79-149) C-terminal domain of arginine repressor {Bacillus stearothermophilus}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml
Timeline for d1b4ac2: